Class b: All beta proteins [48724] (174 folds) |
Fold b.67: 5-bladed beta-propeller [50933] (3 superfamilies) consists of five 4-stranded beta-sheet motifs; meander |
Superfamily b.67.2: Arabinanase/levansucrase/invertase [75005] (6 families) |
Family b.67.2.0: automated matches [227228] (1 protein) not a true family |
Protein automated matches [226971] (1 species) not a true protein |
Species Selenomonas ruminantium [TaxId:971] [225444] (1 PDB entry) |
Domain d3c2ub1: 3c2u B:1-326 [208770] Other proteins in same PDB: d3c2ua2, d3c2ub2, d3c2uc2, d3c2ud2 automated match to d2exja2 complexed with b3p |
PDB Entry: 3c2u (more details), 1.3 Å
SCOPe Domain Sequences for d3c2ub1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c2ub1 b.67.2.0 (B:1-326) automated matches {Selenomonas ruminantium [TaxId: 971]} mniqnpvlkgfnpdpsivragddyyiatstfewfpgvqihhskdlvhwhlvahplsttef ldmkgnpdsggiwapdlsyadgkfwliytdvkvvdgmwkdchnylttaedikgpwskpil lngagfdaslfhdpsgkkylvnmywdqrvyhhnfygialqeysvaeekligkpeiiykgt diaytegphlyyindmyylmtaeggttyqhsetiarsktihgpyeiqpdypllsawkevh nplqkcghaslvetqngqwylahltgrplpapagfpsrereqhafcplgretaiqkiewq dgwpvvvggqqgsleveapdlpqqew
Timeline for d3c2ub1: