Lineage for d3c22d_ (3c22 D:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1682071Fold d.169: C-type lectin-like [56435] (1 superfamily)
    unusual fold
  4. 1682072Superfamily d.169.1: C-type lectin-like [56436] (9 families) (S)
  5. 1682776Family d.169.1.0: automated matches [191331] (1 protein)
    not a true family
  6. 1682777Protein automated matches [190159] (12 species)
    not a true protein
  7. 1682825Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries)
  8. 1682844Domain d3c22d_: 3c22 D: [208767]
    automated match to d3p5hc_
    complexed with ca, mg

Details for d3c22d_

PDB Entry: 3c22 (more details), 1.5 Å

PDB Description: Crystal structure of the carbohydrate recognition domain of human Langerin
PDB Compounds: (D:) C-type lectin domain family 4 member K

SCOPe Domain Sequences for d3c22d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3c22d_ d.169.1.0 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
vsqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywig
ltkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdkt
flfickrpyvpsep

SCOPe Domain Coordinates for d3c22d_:

Click to download the PDB-style file with coordinates for d3c22d_.
(The format of our PDB-style files is described here.)

Timeline for d3c22d_: