Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.169: C-type lectin-like [56435] (1 superfamily) unusual fold |
Superfamily d.169.1: C-type lectin-like [56436] (9 families) |
Family d.169.1.0: automated matches [191331] (1 protein) not a true family |
Protein automated matches [190159] (12 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [186882] (61 PDB entries) |
Domain d3c22a_: 3c22 A: [208764] automated match to d3p5hc_ complexed with ca, mg |
PDB Entry: 3c22 (more details), 1.5 Å
SCOPe Domain Sequences for d3c22a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3c22a_ d.169.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]} sqgwkyfkgnfyyfslipktwysaeqfcvsrnshltsvtseseqeflyktaggliywigl tkagmegdwswvddtpfnkvqsarfwipgepnnagnnehcgnikapslqawndapcdktf lfickrpyvp
Timeline for d3c22a_: