Lineage for d1igyb3 (1igy B:236-361)

  1. Root: SCOP 1.57
  2. 51639Class b: All beta proteins [48724] (104 folds)
  3. 51640Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 51641Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 52912Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 53260Protein Immunoglobulin (constant domains of L and H chains) [48972] (161 species)
  7. 54065Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48974] (1 PDB entry)
  8. 54068Domain d1igyb3: 1igy B:236-361 [20876]
    Other proteins in same PDB: d1igya1, d1igyb1, d1igyc1, d1igyd1

Details for d1igyb3

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin (constant domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
gckpcictvpevssvfifppkpkdtllitvtpkvtcvvvdiskddpevqfswfvdnvevh
taqtqpreeqfnstfrvvsalpimhqdwlngkefkcrvnsaafpapiektisktkg

SCOP Domain Coordinates for d1igyb3:

Click to download the PDB-style file with coordinates for d1igyb3.
(The format of our PDB-style files is described here.)

Timeline for d1igyb3: