![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [88586] (1 PDB entry) |
![]() | Domain d1igyb3: 1igy B:236-361 [20876] Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb2, d1igyb4, d1igyc1, d1igyc2, d1igyd1, d1igyd2, d1igyd4 part of intact IgG1 antibody Mab61.1.3 |
PDB Entry: 1igy (more details), 3.2 Å
SCOPe Domain Sequences for d1igyb3:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igyb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus) [TaxId: 10090]} gckpcictvpevssvfifppkpkdtllitvtpkvtcvvvdiskddpevqfswfvdnvevh taqtqpreeqfnstfrvvsalpimhqdwlngkefkcrvnsaafpapiektisktkg
Timeline for d1igyb3: