Class b: All beta proteins [48724] (165 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries) |
Domain d1igyb2: 1igy B:114-235 [20875] Other proteins in same PDB: d1igya1, d1igya2, d1igyb1, d1igyb3, d1igyb4, d1igyc1, d1igyc2, d1igyd1, d1igyd3, d1igyd4 |
PDB Entry: 1igy (more details), 3.2 Å
SCOP Domain Sequences for d1igyb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igyb2 b.1.1.2 (B:114-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]} akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc
Timeline for d1igyb2: