Lineage for d1igyb2 (1igy B:114-235)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8462Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)
  7. 9207Species Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain [48974] (1 PDB entry)
  8. 9209Domain d1igyb2: 1igy B:114-235 [20875]
    Other proteins in same PDB: d1igya1, d1igyb1, d1igyc1, d1igyd1

Details for d1igyb2

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igyb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igyb2 b.1.1.2 (B:114-235) Immunoglobulin (constant domains of L and H chains) {Intact IgG1 antibody Mab61.1.3 (mouse), kappa L chain}
akttppsvyplapgsaaqtnsmvtlgclvkgyfpepvtvtwnsgslssgvhtfpavlqsd
lytlsssvtvpssprpsetvtcnvahpasstkvdkkivprdc

SCOP Domain Coordinates for d1igyb2:

Click to download the PDB-style file with coordinates for d1igyb2.
(The format of our PDB-style files is described here.)

Timeline for d1igyb2: