Lineage for d1igya2 (1igy A:108-214)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656454Domain d1igya2: 1igy A:108-214 [20874]
    Other proteins in same PDB: d1igya1, d1igyb1, d1igyb2, d1igyb3, d1igyb4, d1igyc1, d1igyd1, d1igyd2, d1igyd3, d1igyd4

Details for d1igya2

PDB Entry: 1igy (more details), 3.2 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (A:) igg1 intact antibody mab61.1.3

SCOP Domain Sequences for d1igya2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igya2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1igya2:

Click to download the PDB-style file with coordinates for d1igya2.
(The format of our PDB-style files is described here.)

Timeline for d1igya2: