Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88567] (284 PDB entries) |
Domain d1igya2: 1igy A:108-214 [20874] Other proteins in same PDB: d1igya1, d1igyb1, d1igyb2, d1igyb3, d1igyb4, d1igyc1, d1igyd1, d1igyd2, d1igyd3, d1igyd4 |
PDB Entry: 1igy (more details), 3.2 Å
SCOP Domain Sequences for d1igya2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igya2 b.1.1.2 (A:108-214) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus)} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1igya2: