Lineage for d1igtd4 (1igt D:363-474)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 103650Protein Immunoglobulin (constant domains of L and H chains) [48972] (169 species)
  7. 104509Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48973] (1 PDB entry)
  8. 104517Domain d1igtd4: 1igt D:363-474 [20873]
    Other proteins in same PDB: d1igta1, d1igtb1, d1igtc1, d1igtd1

Details for d1igtd4

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtd4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd4 b.1.1.2 (D:363-474) Immunoglobulin (constant domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOP Domain Coordinates for d1igtd4:

Click to download the PDB-style file with coordinates for d1igtd4.
(The format of our PDB-style files is described here.)

Timeline for d1igtd4: