Lineage for d1igtd2 (1igt D:115-235)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655111Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 655348Species Mouse (Mus musculus) [TaxId:10090] [88576] (330 PDB entries)
  8. 655632Domain d1igtd2: 1igt D:115-235 [20871]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb3, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd3, d1igtd4
    part of intact IgG2a antibody Mab231
    complexed with fuc, gal, man, nag

Details for d1igtd2

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (D:) igg2a intact antibody - mab231

SCOP Domain Sequences for d1igtd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtd2 b.1.1.2 (D:115-235) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus) [TaxId: 10090]}
kttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsdl
ytlsssvtvtsstwpsqsitcnvahpasstkvdkkieprgptik

SCOP Domain Coordinates for d1igtd2:

Click to download the PDB-style file with coordinates for d1igtd2.
(The format of our PDB-style files is described here.)

Timeline for d1igtd2: