SCOP 1.55: Domain d1igtc2: 1igt C:109-214

Lineage for d1igtc2 (1igt C:109-214)

1. Root: SCOP 1.55

2. Class b: All beta proteins [48724] (93 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Immunoglobulin (constant domains of L and H chains) [48972] (152 species)

7. Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48973] (1 PDB entry)

8. Domain d1igtc2: 1igt C:109-214 [20870]
   Other proteins in same PDB: d1igta1, d1igtb1, d1igtc1, d1igtd1

Details for d1igtc2

PDB Entry: 1igt, 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtc2:

Sequence; same for both SEQRES and ATOM records:

>d1igtc2 b.1.1.2 (C:109-214) Immunoglobulin (constant domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds
kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

Timeline for d1igtc2:

• d1igtc2 appears in SCOP 1.57
  
• d1igtc2 appears in the current release, SCOPe 2.08