Lineage for d3bpxa_ (3bpx A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260247Species Methanobacterium thermoautotrophicum [TaxId:145262] [225456] (2 PDB entries)
  8. 1260249Domain d3bpxa_: 3bpx A: [208691]
    automated match to d2ethb_
    complexed with na, sal

Details for d3bpxa_

PDB Entry: 3bpx (more details), 1.95 Å

PDB Description: Crystal Structure of MarR
PDB Compounds: (A:) Transcriptional regulator

SCOPe Domain Sequences for d3bpxa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bpxa_ a.4.5.0 (A:) automated matches {Methanobacterium thermoautotrophicum}
shmdrdiplkgllsiilrshrvfigrelghlnltdaqvacllrihrepgikqdelatffh
vdkgtiartlrrleesgfiereqdpenrrryilevtrrgeeiiplilkveerwedllfrd
ftederklfrkmcrrlaeeavrmrgew

SCOPe Domain Coordinates for d3bpxa_:

Click to download the PDB-style file with coordinates for d3bpxa_.
(The format of our PDB-style files is described here.)

Timeline for d3bpxa_: