Lineage for d1igtb4 (1igt B:363-474)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655861Protein Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma [88589] (5 species)
  7. 655918Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88592] (1 PDB entry)
  8. 655919Domain d1igtb4: 1igt B:363-474 [20869]
    Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb3, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd3

Details for d1igtb4

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin
PDB Compounds: (B:) igg2a intact antibody - mab231

SCOP Domain Sequences for d1igtb4:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtb4 b.1.1.2 (B:363-474) Immunoglobulin heavy chain gamma constant domain 3, CH3-gamma {Mouse (Mus musculus), gamma2 [TaxId: 10090]}
svrapqvyvlpppeeemtkkqvtltcmvtdfmpediyvewtnngktelnykntepvldsd
gsyfmysklrvekknwvernsyscsvvheglhnhhttksfsr

SCOP Domain Coordinates for d1igtb4:

Click to download the PDB-style file with coordinates for d1igtb4.
(The format of our PDB-style files is described here.)

Timeline for d1igtb4: