SCOP 1.65: Domain d1igtb3: 1igt B:236-361

Lineage for d1igtb3 (1igt B:236-361)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma [88584] (4 species)

7. Species Mouse (Mus musculus), gamma2 [TaxId:10090] [88587] (1 PDB entry)

8. Domain d1igtb3: 1igt B:236-361 [20868]
   Other proteins in same PDB: d1igta1, d1igta2, d1igtb1, d1igtb2, d1igtb4, d1igtc1, d1igtc2, d1igtd1, d1igtd2, d1igtd4

Details for d1igtb3

PDB Entry: 1igt, 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtb3:

Sequence; same for both SEQRES and ATOM records:

>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin heavy chain gamma constant domain 2, CH2-gamma {Mouse (Mus musculus), gamma2}
pcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnv
evhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkg

Timeline for d1igtb3:

• d1igtb3 first appeared (with stable ids) in SCOP 1.55
  
• d1igtb3 appears in SCOP 1.63
  
• d1igtb3 appears in SCOP 1.67
  
• d1igtb3 appears in the current release, SCOPe 2.08