Lineage for d1igtb3 (1igt B:236-361)

  1. Root: SCOP 1.61
  2. 157351Class b: All beta proteins [48724] (111 folds)
  3. 157352Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies)
  4. 157353Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 158799Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 159225Protein Immunoglobulin (constant domains of L and H chains) [48972] (180 species)
  7. 160140Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48973] (1 PDB entry)
  8. 160143Domain d1igtb3: 1igt B:236-361 [20868]
    Other proteins in same PDB: d1igta1, d1igtb1, d1igtc1, d1igtd1

Details for d1igtb3

PDB Entry: 1igt (more details), 2.8 Å

PDB Description: structure of immunoglobulin

SCOP Domain Sequences for d1igtb3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1igtb3 b.1.1.2 (B:236-361) Immunoglobulin (constant domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain}
pcppckcpapnllggpsvfifppkikdvlmislspivtcvvvdvseddpdvqiswfvnnv
evhtaqtqthredynstlrvvsalpiqhqdwmsgkefkckvnnkdlpapiertiskpkg

SCOP Domain Coordinates for d1igtb3:

Click to download the PDB-style file with coordinates for d1igtb3.
(The format of our PDB-style files is described here.)

Timeline for d1igtb3: