Class b: All beta proteins [48724] (119 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) |
Protein Immunoglobulin (constant domains of L and H chains) [48972] (185 species) |
Species Intact IgG2a antibody Mab231 (mouse), kappa L chain [48973] (1 PDB entry) |
Domain d1igta2: 1igt A:109-214 [20866] Other proteins in same PDB: d1igta1, d1igtb1, d1igtc1, d1igtd1 |
PDB Entry: 1igt (more details), 2.8 Å
SCOP Domain Sequences for d1igta2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1igta2 b.1.1.2 (A:109-214) Immunoglobulin (constant domains of L and H chains) {Intact IgG2a antibody Mab231 (mouse), kappa L chain} adaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqds kdstysmsstltltkdeyerhnsytceathktstspivksfnrnec
Timeline for d1igta2: