SCOPe 2.06: Domain d3bgub1: 3bgu B:1-97

Lineage for d3bgub1 (3bgu B:1-97)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (27 species)
   not a true protein

7. Species Thermobifida fusca [TaxId:269800] [225385] (1 PDB entry)

8. Domain d3bgub1: 3bgu B:1-97 [208643]
   Other proteins in same PDB: d3bgua2, d3bgub2
   automated match to d1tr0a_
   complexed with act, cl, edo, nbz

Details for d3bgub1

PDB Entry: 3bgu, 1.5 Å

PDB Description: crystal structure of a dimeric ferredoxin-like protein of unknown function (tfu_0763) from thermobifida fusca yx at 1.50 a resolution

PDB Compounds: (B:) Ferredoxin-like protein of unknown function

SCOPe Domain Sequences for d3bgub1:

Sequence; same for both SEQRES and ATOM records:

>d3bgub1 d.58.4.0 (B:1-97) automated matches {Thermobifida fusca [TaxId: 269800]}
mgirhialfrwndtvtpdqveqvitalsklpaaipelknyafgadlglaagnydfavvad
ldgedgfrayqdhpdhraalaiiapmladrvavqfal

Timeline for d3bgub1:

• d3bgub1 first appeared in SCOPe 2.03, called d3bgub_
  
• d3bgub1 was called d3bgub_ in SCOPe 2.05
  
• d3bgub1 appears in SCOPe 2.07
  
• d3bgub1 appears in the current release, SCOPe 2.08