SCOPe 2.06: Domain d3bfra2: 3bfr A:99-213

Lineage for d3bfra2 (3bfr A:99-213)

1. Root: SCOPe 2.06

2. Class d: Alpha and beta proteins (a+b) [53931] (385 folds)

3. Fold d.44: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54718] (1 superfamily)
   alpha-beta(2)-alpha-beta-alpha(2); 3 strands of antiparallel sheet: 213

4. Superfamily d.44.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54719] (2 families)
   automatically mapped to Pfam PF02777

5. Family d.44.1.1: Fe,Mn superoxide dismutase (SOD), C-terminal domain [54720] (4 proteins)

6. Protein Mn superoxide dismutase (MnSOD) [54721] (9 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [225565] (1 PDB entry)

8. Domain d3bfra2: 3bfr A:99-213 [208641]
   Other proteins in same PDB: d3bfra1
   automated match to d1kkca2
   complexed with mn3

Details for d3bfra2

PDB Entry: 3bfr, 2.05 Å

PDB Description: The crystal structure of Sod2 from Saccharomyces cerevisiae

PDB Compounds: (A:) Superoxide dismutase [Mn]

SCOPe Domain Sequences for d3bfra2:

Sequence; same for both SEQRES and ATOM records:

>d3bfra2 d.44.1.1 (A:99-213) Mn superoxide dismutase (MnSOD) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
esqgggepptgalakaideqfgsldelikltntklagvqgsgwafivknlsnggkldvvq
tynqdtvtgplvplvaidawehayylqyqnkkadyfkaiwnvvnwkeasrrfdag

Timeline for d3bfra2:

• d3bfra2 first appeared in SCOPe 2.03
  
• d3bfra2 appears in SCOPe 2.05
  
• d3bfra2 appears in SCOPe 2.07
  
• d3bfra2 appears in the current release, SCOPe 2.08