Lineage for d1exua1 (1exu A:177-267)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104613Protein MHC-related Fc receptor [48970] (1 species)
  7. 104614Species Human (Homo sapiens) [TaxId:9606] [48971] (1 PDB entry)
  8. 104615Domain d1exua1: 1exu A:177-267 [20864]
    Other proteins in same PDB: d1exua2

Details for d1exua1

PDB Entry: 1exu (more details), 2.7 Å

PDB Description: crystal structure of the human mhc-related fc receptor

SCOP Domain Sequences for d1exua1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1exua1 b.1.1.2 (A:177-267) MHC-related Fc receptor {Human (Homo sapiens)}
keppsmrlkarpsspgfsvltcsafsfyppelqlrflrnglaagtgqgdfgpnsdgsfha
sssltvksgdehhyccivqhaglaqplrvel

SCOP Domain Coordinates for d1exua1:

Click to download the PDB-style file with coordinates for d1exua1.
(The format of our PDB-style files is described here.)

Timeline for d1exua1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1exua2
View in 3D
Domains from other chains:
(mouse over for more information)
d1exub1