SCOPe 2.04: Domain d3bfca_: 3bfc A:

Lineage for d3bfca_ (3bfc A:)

1. Root: SCOPe 2.04

2. Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)

3. Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily)
   contains a cluster of helices and an alpha+beta sandwich

4. Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families)

5. Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins)

6. Protein automated matches [190161] (19 species)
   not a true protein

7. Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries)

8. Domain d3bfca_: 3bfc A: [208632]
   automated match to d3bffd_
   complexed with im2

Details for d3bfca_

PDB Entry: 3bfc, 2.2 Å

PDB Description: class A beta-lactamase SED-G238C complexed with imipenem

PDB Compounds: (A:) Class A beta-lactamase Sed1

SCOPe Domain Sequences for d3bfca_:

Sequence; same for both SEQRES and ATOM records:

>d3bfca_ e.3.1.1 (A:) automated matches {Citrobacter sedlakii [TaxId: 67826]}
vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset
hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg
nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq
lvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftqp
qqdakwrkdvlaaaakivtegk

Timeline for d3bfca_:

• d3bfca_ first appeared in SCOPe 2.03
  
• d3bfca_ appears in SCOPe 2.05
  
• d3bfca_ appears in the current release, SCOPe 2.08