Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds) |
Fold e.3: beta-lactamase/transpeptidase-like [56600] (1 superfamily) contains a cluster of helices and an alpha+beta sandwich |
Superfamily e.3.1: beta-lactamase/transpeptidase-like [56601] (4 families) |
Family e.3.1.1: beta-Lactamase/D-ala carboxypeptidase [56602] (19 proteins) |
Protein automated matches [190161] (19 species) not a true protein |
Species Citrobacter sedlakii [TaxId:67826] [188289] (5 PDB entries) |
Domain d3bfca_: 3bfc A: [208632] automated match to d3bffd_ complexed with im2 |
PDB Entry: 3bfc (more details), 2.2 Å
SCOPe Domain Sequences for d3bfca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bfca_ e.3.1.1 (A:) automated matches {Citrobacter sedlakii [TaxId: 67826]} vqqvqkklaalekqsggrlgvalintadnsqvlyraderfamcstskvmtaaavlkqset hdgilqqkmtikkadltnwnpvtekyvgntmtlaelsaatlqysdntamnkllahlggpg nvtafarsigdttfrldrkepelntaipgderdttsplamakslrkltlgdalagpqraq lvdwlkgnttggqsiraglpahwvvgdktgacdygttndiaviwpedraplvlvtyftqp qqdakwrkdvlaaaakivtegk
Timeline for d3bfca_: