SCOP 1.67: Domain d1c16g1: 1c16 G:181-276

Lineage for d1c16g1 (1c16 G:181-276)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)

6. Protein Class I MHC homolog, alpha-3 domain [88610] (4 species)
   gamma, delta T-cell ligand

7. Species Mouse (Mus musculus), t22 [TaxId:10090] [88611] (1 PDB entry)

8. Domain d1c16g1: 1c16 G:181-276 [20862]
   Other proteins in same PDB: d1c16a2, d1c16b_, d1c16c2, d1c16d_, d1c16e2, d1c16f_, d1c16g2, d1c16h_

Details for d1c16g1

PDB Entry: 1c16, 3.1 Å

PDB Description: crystal structure analysis of the gamma/delta t cell ligand t22

SCOP Domain Sequences for d1c16g1:

Sequence; same for both SEQRES and ATOM records:

>d1c16g1 b.1.1.2 (G:181-276) Class I MHC homolog, alpha-3 domain {Mouse (Mus musculus), t22}
rsdppkahvtrhprpegdvtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgt
fqkwaavvvplgkeqsytchvyheglpeplilrwgg

Timeline for d1c16g1:

• d1c16g1 first appeared (with stable ids) in SCOP 1.55
  
• d1c16g1 appears in SCOP 1.65
  
• d1c16g1 appears in SCOP 1.69
  
• d1c16g1 appears in the current release, SCOPe 2.08