Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
Fold d.87: CO dehydrogenase flavoprotein C-domain-like [55423] (2 superfamilies) core: beta(3,4)-alpha(3); alpha+beta sandwich |
Superfamily d.87.2: CO dehydrogenase flavoprotein C-terminal domain-like [55447] (2 families) automatically mapped to Pfam PF03450 |
Family d.87.2.1: CO dehydrogenase flavoprotein C-terminal domain-like [55448] (5 proteins) |
Protein Xanthine oxidase, domain 4 (?) [55452] (1 species) |
Species Cow (Bos taurus) [TaxId:9913] [55453] (10 PDB entries) Uniprot P80457 |
Domain d3bdja4: 3bdj A:415-528 [208618] Other proteins in same PDB: d3bdja1, d3bdja2, d3bdja3, d3bdja5, d3bdja6, d3bdjb1, d3bdjb2, d3bdjb3, d3bdjb5, d3bdjb6 automated match to d1v97a4 complexed with 141, ca, co3, fad, fes, gol, mow, mte |
PDB Entry: 3bdj (more details), 2 Å
SCOPe Domain Sequences for d3bdja4:
Sequence; same for both SEQRES and ATOM records: (download)
>d3bdja4 d.87.2.1 (A:415-528) Xanthine oxidase, domain 4 (?) {Cow (Bos taurus) [TaxId: 9913]} deffsafkqasrreddiakvtcgmrvlfqpgsmqvkelalcyggmadrtisalkttqkql skfwnekllqdvcaglaeelslspdapggmiefrrtltlsfffkfyltvlkklg
Timeline for d3bdja4: