Lineage for d3bd5b_ (3bd5 B:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2021376Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2023921Protein automated matches [190119] (22 species)
    not a true protein
  7. 2024733Species Mouse (Mus musculus) [TaxId:10090] [186842] (156 PDB entries)
  8. 2024792Domain d3bd5b_: 3bd5 B: [208614]
    automated match to d1eeqa_
    protein/DNA complex; complexed with btb, co

Details for d3bd5b_

PDB Entry: 3bd5 (more details), 2 Å

PDB Description: Crystal structure of single domain VL of an anti-DNA binding antibody 3D8 scFv and its active site revealed by complex structures of a small molecule and metals
PDB Compounds: (B:) catalytic antibody

SCOPe Domain Sequences for d3bd5b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3bd5b_ b.1.1.1 (B:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
lvmsqspsslavsagekvtmsckssqslfnsrtrknylawyqqkpgqspklliywastre
sgvpdrftgsgsgtdftltissvqaedlavyyckqsyyhmytfgsgtkleik

SCOPe Domain Coordinates for d3bd5b_:

Click to download the PDB-style file with coordinates for d3bd5b_.
(The format of our PDB-style files is described here.)

Timeline for d3bd5b_: