Lineage for d3b9ob_ (3b9o B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2839499Superfamily c.1.16: Bacterial luciferase-like [51679] (5 families) (S)
    consists of clearly related families of somewhat different folds
  5. 2839562Family c.1.16.0: automated matches [191510] (1 protein)
    not a true family
  6. 2839563Protein automated matches [190849] (11 species)
    not a true protein
  7. 2839586Species Geobacillus thermodenitrificans [TaxId:33940] [225395] (2 PDB entries)
  8. 2839588Domain d3b9ob_: 3b9o B: [208575]
    automated match to d3sdoa_
    complexed with fmn

Details for d3b9ob_

PDB Entry: 3b9o (more details), 1.9 Å

PDB Description: long-chain alkane monooxygenase (LadA) in complex with coenzyme FMN
PDB Compounds: (B:) Alkane monoxygenase

SCOPe Domain Sequences for d3b9ob_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b9ob_ c.1.16.0 (B:) automated matches {Geobacillus thermodenitrificans [TaxId: 33940]}
kkihinafemncvghiahglwrhpenqrhrytdlnywtelaqllekgkfdalfladvvgi
ydvyrqsrdtavreavqipvndplmlisamayvtkhlafavtfsttyehpygharrmstl
dhltkgriawnvvtshlpsadknfgikkilehderydladeylevcyklwegswednavi
rdienniytdpskvheinhsgkyfevpgphlcepspqrtpviyqagmsergrefaakhae
cvflggkdvetlkffvddirkrakkygrnpdhikmfagicvivgkthdeameklnsfqky
wsleghlahygggtgydlskyssndyigsisvgeiinnmskldgkwfklsvgtpkkvade
mqylveeagidgfnlvqyvspgtfvdfielvvpelqkrglyrvdyeegtyreklfgkgny
rlpddhiaaryrn

SCOPe Domain Coordinates for d3b9ob_:

Click to download the PDB-style file with coordinates for d3b9ob_.
(The format of our PDB-style files is described here.)

Timeline for d3b9ob_: