SCOPe 2.04: Domain d3b97d1: 3b97 D:1-139

Lineage for d3b97d1 (3b97 D:1-139)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (67 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225519] (3 PDB entries)

8. Domain d3b97d1: 3b97 D:1-139 [208568]
   Other proteins in same PDB: d3b97a2, d3b97b2, d3b97c2, d3b97d2
   automated match to d1pdza2
   complexed with mg, so4

Details for d3b97d1

PDB Entry: 3b97, 2.2 Å

PDB Description: Crystal Structure of human Enolase 1

PDB Compounds: (D:) Alpha-enolase

SCOPe Domain Sequences for d3b97d1:

Sequence; same for both SEQRES and ATOM records:

>d3b97d1 d.54.1.0 (D:1-139) automated matches {Human (Homo sapiens) [TaxId: 9606]}
silkihareifdsrgnptvevdlftskglfraavpsgastgiyealelrdndktrymgkg
vskavehinktiapalvskklnvteqekidklmiemdgtenkskfganailgvslavcka
gavekgvplyrhiadlagn

Timeline for d3b97d1:

• d3b97d1 first appeared in SCOPe 2.03
  
• d3b97d1 appears in SCOPe 2.05
  
• d3b97d1 appears in the current release, SCOPe 2.08