SCOPe 2.05: Domain d3b97c2: 3b97 C:140-433

Lineage for d3b97c2 (3b97 C:140-433)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.1: Enolase [51605] (2 proteins)
   automatically mapped to Pfam PF00113

6. Protein automated matches [226973] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries)

8. Domain d3b97c2: 3b97 C:140-433 [208567]
   Other proteins in same PDB: d3b97a1, d3b97b1, d3b97c1, d3b97d1
   automated match to d1pdza1
   complexed with mg, so4

Details for d3b97c2

PDB Entry: 3b97, 2.2 Å

PDB Description: Crystal Structure of human Enolase 1

PDB Compounds: (C:) Alpha-enolase

SCOPe Domain Sequences for d3b97c2:

Sequence; same for both SEQRES and ATOM records:

>d3b97c2 c.1.11.1 (C:140-433) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky
gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld
fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl
tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnplak

Timeline for d3b97c2:

• d3b97c2 first appeared in SCOPe 2.03
  
• d3b97c2 appears in SCOPe 2.04
  
• d3b97c2 appears in SCOPe 2.06
  
• d3b97c2 appears in the current release, SCOPe 2.08