Lineage for d3b97a2 (3b97 A:140-432)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2089714Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2098969Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2098970Family c.1.11.1: Enolase [51605] (2 proteins)
    automatically mapped to Pfam PF00113
  6. 2099072Protein automated matches [226973] (6 species)
    not a true protein
  7. 2099085Species Human (Homo sapiens) [TaxId:9606] [225520] (3 PDB entries)
  8. 2099092Domain d3b97a2: 3b97 A:140-432 [208563]
    Other proteins in same PDB: d3b97a1, d3b97b1, d3b97c1, d3b97d1
    automated match to d1pdza1
    complexed with mg, so4

Details for d3b97a2

PDB Entry: 3b97 (more details), 2.2 Å

PDB Description: Crystal Structure of human Enolase 1
PDB Compounds: (A:) Alpha-enolase

SCOPe Domain Sequences for d3b97a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b97a2 c.1.11.1 (A:140-432) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sevilpvpafnvinggshagnklamqefmilpvgaanfreamrigaevyhnlknvikeky
gkdatnvgdeggfapnilenkeglellktaigkagytdkvvigmdvaaseffrsgkydld
fkspddpsryispdqladlyksfikdypvvsiedpfdqddwgawqkftasagiqvvgddl
tvtnpkriakavnekscnclllkvnqigsvteslqacklaqangwgvmvshrsgetedtf
iadlvvglctgqiktgapcrserlakynqllrieeelgskakfagrnfrnpla

SCOPe Domain Coordinates for d3b97a2:

Click to download the PDB-style file with coordinates for d3b97a2.
(The format of our PDB-style files is described here.)

Timeline for d3b97a2: