Lineage for d1b3ja1 (1b3j A:181-274)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 101938Superfamily b.1.1: Immunoglobulin [48726] (6 families) (S)
  5. 103279Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 104600Protein MHC I homolog [48967] (2 species)
  7. 104601Species Human (Homo sapiens), Mic-a [TaxId:9606] [48968] (2 PDB entries)
  8. 104603Domain d1b3ja1: 1b3j A:181-274 [20855]
    Other proteins in same PDB: d1b3ja2

Details for d1b3ja1

PDB Entry: 1b3j (more details), 3 Å

PDB Description: structure of the mhc class i homolog mic-a, a gammadelta t cell ligand

SCOP Domain Sequences for d1b3ja1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1b3ja1 b.1.1.2 (A:181-274) MHC I homolog {Human (Homo sapiens), Mic-a}
tvppmvnvtrseasegnitvtcrasgfypwnitlswrqdgvslshdtqqwgdvlpdgngt
yqtwvatricqgeeqrftcymehsgnhsthpvps

SCOP Domain Coordinates for d1b3ja1:

Click to download the PDB-style file with coordinates for d1b3ja1.
(The format of our PDB-style files is described here.)

Timeline for d1b3ja1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1b3ja2