SCOPe 2.08: Domain d3b7ga_: 3b7g A:

Lineage for d3b7ga_ (3b7g A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d3b7ga_: 3b7g A: [208547]
   automated match to d1t6na_
   protein/DNA complex; protein/RNA complex; complexed with anp

Details for d3b7ga_

PDB Entry: 3b7g, 1.9 Å

PDB Description: Human DEAD-box RNA helicase DDX20, Conserved domain I (DEAD) in complex with AMPPNP (Adenosine-(Beta,gamma)-imidotriphosphate)

PDB Compounds: (A:) Probable ATP-dependent RNA helicase DDX20

SCOPe Domain Sequences for d3b7ga_:

Sequence; same for both SEQRES and ATOM records:

>d3b7ga_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adfeslllsrpvleglraagferpspvqlkaiplgrcgldlivqaksgtgktcvfstial
dslvlenlstqililaptreiavqihsvitaigikmeglechvfiggtplsqdktrlkkc
hiavgspgrikqlieldylnpgsirlfildeadklleegsfqeqinwiysslpaskqmla
vsatypeflanaltkymrdptfvrl

Timeline for d3b7ga_:

• d3b7ga_ first appeared in SCOPe 2.03
  
• d3b7ga_ appears in SCOPe 2.07