SCOPe 2.03: Domain d3b6ra2: 3b6r A:103-381

Lineage for d3b6ra2 (3b6r A:103-381)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.128: Glutamine synthetase/guanido kinase [55930] (1 superfamily)
   duplication: common core consists of two beta-alpha-beta2-alpha repeats

4. Superfamily d.128.1: Glutamine synthetase/guanido kinase [55931] (6 families)

5. Family d.128.1.2: Guanido kinase catalytic domain [55935] (3 proteins)
   automatically mapped to Pfam PF00217

6. Protein automated matches [226885] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225066] (4 PDB entries)

8. Domain d3b6ra2: 3b6r A:103-381 [208542]
   Other proteins in same PDB: d3b6ra1, d3b6rb1
   automated match to d1g0wa2
   complexed with act, adp, crn, mg, no3

Details for d3b6ra2

PDB Entry: 3b6r, 2 Å

PDB Description: crystal structure of human brain-type creatine kinase

PDB Compounds: (A:) Creatine kinase B-type

SCOPe Domain Sequences for d3b6ra2:

Sequence; same for both SEQRES and ATOM records:

>d3b6ra2 d.128.1.2 (A:103-381) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sdehktdlnpdnlqggddldpnyvlssrvrtgrsirgfclpphcsrgerraieklaveal
ssldgdlagryyalksmteaeqqqliddhflfdkpvsplllasgmardwpdargiwhndn
ktflvwvneedhlrvismqkggnmkevftrfctgltqietlfkskdyefmwnphlgyilt
cpsnlgtglragvhiklpnlgkhekfsevlkrlrlqkrgtggvdtaavggvfdvsnadrl
gfsevelvqmvvdgvklliemeqrleqgqaiddlmpaqk

Timeline for d3b6ra2:

• d3b6ra2 is new in SCOPe 2.03-stable
  
• d3b6ra2 appears in SCOPe 2.04
  
• d3b6ra2 appears in the current release, SCOPe 2.08