SCOPe 2.08: Domain d1zagd1: 1zag D:184-276

Lineage for d1zagd1 (1zag D:184-276)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species)
   fat depleting factor related to class I MHC

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (8 PDB entries)
   Uniprot P25311 22-294

8. Domain d1zagd1: 1zag D:184-276 [20854]
   Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2
   complexed with nag

Details for d1zagd1

PDB Entry: 1zag, 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

PDB Compounds: (D:) protein (zinc-alpha-2-glycoprotein)

SCOPe Domain Sequences for d1zagd1:

Sequence, based on SEQRES records:

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpwe

Sequence, based on observed residues (ATOM records):

>d1zagd1 b.1.1.2 (D:184-276) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvayschvqhsslaqplvvpwe

Timeline for d1zagd1:

• d1zagd1 first appeared (with stable ids) in SCOP 1.55
  
• d1zagd1 appears in SCOPe 2.07