SCOPe 2.08: Domain d3b4tf1: 3b4t F:1-151

Lineage for d3b4tf1 (3b4t F:1-151)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (13 families)

5. Family d.14.1.0: automated matches [191504] (1 protein)
   not a true family

6. Protein automated matches [190826] (23 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [225380] (3 PDB entries)

8. Domain d3b4tf1: 3b4t F:1-151 [208531]
   Other proteins in same PDB: d3b4ta2, d3b4tb2, d3b4tc2, d3b4td2, d3b4te2, d3b4tf2
   automated match to d1r6la1
   complexed with po4

Details for d3b4tf1

PDB Entry: 3b4t, 2.1 Å

PDB Description: crystal structure of mycobacterium tuberculosis rnase ph, the mycobacterium tuberculosis structural genomics consortium target rv1340

PDB Compounds: (F:) Ribonuclease PH

SCOPe Domain Sequences for d3b4tf1:

Sequence, based on SEQRES records:

>d3b4tf1 d.14.1.0 (F:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvprwrkatglgwl
taeyamlpsathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvl
qadggtrtaaitgayvaladavtylsaagkl

Sequence, based on observed residues (ATOM records):

>d3b4tf1 d.14.1.0 (F:1-151) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
skredgrldhelrpviitrgftenpagsvliefghtkvlctasvtegvplgwltaeyaml
psathsrsdresvrgrlsgrtqeisrligrslracidlaalgentiaidcdvlqadggtr
taaitgayvaladavtylsaagkl

Timeline for d3b4tf1:

• d3b4tf1 first appeared in SCOPe 2.03
  
• d3b4tf1 appears in SCOPe 2.07