SCOP 1.57: Domain d1zagc1: 1zag C:184-278

Lineage for d1zagc1 (1zag C:184-278)

1. Root: SCOP 1.57

2. Class b: All beta proteins [48724] (104 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein Zinc-alpha-2-glycoprotein, ZAG [48965] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [48966] (1 PDB entry)

8. Domain d1zagc1: 1zag C:184-278 [20853]
   Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2

Details for d1zagc1

PDB Entry: 1zag, 2.8 Å

PDB Description: human zinc-alpha-2-glycoprotein

SCOP Domain Sequences for d1zagc1:

Sequence; same for both SEQRES and ATOM records:

>d1zagc1 b.1.1.2 (C:184-278) Zinc-alpha-2-glycoprotein, ZAG {Human (Homo sapiens)}
qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq
swvvvavppqdtapyschvqhsslaqplvvpweas

Timeline for d1zagc1:

• d1zagc1 first appeared (with stable ids) in SCOP 1.55
  
• d1zagc1 appears in SCOP 1.59
  
• d1zagc1 appears in the current release, SCOPe 2.08