Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.101: Ribonuclease PH domain 2-like [55665] (1 superfamily) beta(2)-alpha-beta(2)-alpha; 3 layers: alpha/beta/alpha; antiparallel sheet: order 2134 |
Superfamily d.101.1: Ribonuclease PH domain 2-like [55666] (2 families) |
Family d.101.1.0: automated matches [227218] (1 protein) not a true family |
Protein automated matches [226956] (5 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [225381] (1 PDB entry) |
Domain d3b4tc2: 3b4t C:152-247 [208526] Other proteins in same PDB: d3b4ta1, d3b4tb1, d3b4tc1, d3b4td1, d3b4te1, d3b4tf1 automated match to d1r6la2 complexed with po4 |
PDB Entry: 3b4t (more details), 2.1 Å
SCOPe Domain Sequences for d3b4tc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b4tc2 d.101.1.0 (C:152-247) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} sdprplscaiaavsvgvvdgrirvdlpyeedsraevdmnvvatdtgtlveiqgtgegatf arstldklldmalgacdtlfaaqrdalalpypgvlp
Timeline for d3b4tc2: