SCOPe 2.04: Domain d3b4mb_: 3b4m B:

Lineage for d3b4mb_ (3b4m B:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD [54928] (6 families)

5. Family d.58.7.0: automated matches [191529] (1 protein)
   not a true family

6. Protein automated matches [190896] (7 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188315] (59 PDB entries)

8. Domain d3b4mb_: 3b4m B: [208518]
   automated match to d2cpea1

Details for d3b4mb_

PDB Entry: 3b4m, 2.82 Å

PDB Description: Crystal Structure of Human PABPN1 RRM

PDB Compounds: (B:) Polyadenylate-binding protein 2

SCOPe Domain Sequences for d3b4mb_:

Sequence; same for both SEQRES and ATOM records:

>d3b4mb_ d.58.7.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
adarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrt
slaldeslfrgrqikvipkr

Timeline for d3b4mb_:

• d3b4mb_ first appeared in SCOPe 2.03
  
• d3b4mb_ appears in SCOPe 2.05
  
• d3b4mb_ appears in the current release, SCOPe 2.08