Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.1: CheY-like [52172] (8 families) |
Family c.23.1.0: automated matches [191324] (1 protein) not a true family |
Protein automated matches [190131] (54 species) not a true protein |
Species Staphylococcus aureus [TaxId:1280] [225365] (1 PDB entry) |
Domain d3b2na_: 3b2n A: [208513] automated match to d3crnb_ complexed with na |
PDB Entry: 3b2n (more details), 2.04 Å
SCOPe Domain Sequences for d3b2na_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3b2na_ c.23.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]} ltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiempgm tglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkvnn
Timeline for d3b2na_: