Lineage for d3b2na_ (3b2n A:)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1356043Superfamily c.23.1: CheY-like [52172] (8 families) (S)
  5. 1356404Family c.23.1.0: automated matches [191324] (1 protein)
    not a true family
  6. 1356405Protein automated matches [190131] (48 species)
    not a true protein
  7. 1356570Species Staphylococcus aureus [TaxId:1280] [225365] (1 PDB entry)
  8. 1356571Domain d3b2na_: 3b2n A: [208513]
    automated match to d3crnb_
    complexed with na

Details for d3b2na_

PDB Entry: 3b2n (more details), 2.04 Å

PDB Description: crystal structure of dna-binding response regulator, luxr family, from staphylococcus aureus
PDB Compounds: (A:) Uncharacterized protein Q99UF4

SCOPe Domain Sequences for d3b2na_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3b2na_ c.23.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
ltsliiaedqnmlrqamvqliklhgdfeiladtdngldamklieeynpnvvildiempgm
tglevlaeirkkhlnikviivttfkrpgyfekavvndvdayvlkersieelvetinkvnn

SCOPe Domain Coordinates for d3b2na_:

Click to download the PDB-style file with coordinates for d3b2na_.
(The format of our PDB-style files is described here.)

Timeline for d3b2na_: