Class b: All beta proteins [48724] (177 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain [48965] (1 species) fat depleting factor related to class I MHC |
Species Human (Homo sapiens) [TaxId:9606] [48966] (7 PDB entries) Uniprot P25311 22-294 |
Domain d1zaga1: 1zag A:184-277 [20851] Other proteins in same PDB: d1zaga2, d1zagb2, d1zagc2, d1zagd2 complexed with nag, ndg |
PDB Entry: 1zag (more details), 2.8 Å
SCOPe Domain Sequences for d1zaga1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zaga1 b.1.1.2 (A:184-277) Zinc-alpha-2-glycoprotein, ZAG, alpha-3 domain {Human (Homo sapiens) [TaxId: 9606]} qdppsvvvtshqapgekkklkclaydfypgkidvhwtragevqepelrgdvlhngngtyq swvvvavppqdtapyschvqhsslaqplvvpwea
Timeline for d1zaga1: