SCOPe 2.06: Domain d1ed3e_: 1ed3 E:

Lineage for d1ed3e_ (1ed3 E:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein beta2-microglobulin [88600] (6 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries)

8. Domain d1ed3e_: 1ed3 E: [20850]
   Other proteins in same PDB: d1ed3a1, d1ed3a2, d1ed3d1, d1ed3d2

Details for d1ed3e_

PDB Entry: 1ed3, 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.

PDB Compounds: (E:) Beta-2-microglobulin

SCOPe Domain Sequences for d1ed3e_:

Sequence; same for both SEQRES and ATOM records:

>d1ed3e_ b.1.1.2 (E:) beta2-microglobulin {Norway rat (Rattus norvegicus) [TaxId: 10116]}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

Timeline for d1ed3e_:

• d1ed3e_ first appeared (with stable ids) in SCOP 1.55, called d1ed3e1
  
• d1ed3e_ appears in SCOPe 2.05
  
• d1ed3e_ appears in SCOPe 2.07
  
• d1ed3e_ appears in the current release, SCOPe 2.08