![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (4 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
![]() | Protein beta2-microglobulin [88600] (4 species) |
![]() | Species Rat (Rattus norvegicus) [TaxId:10116] [88601] (6 PDB entries) |
![]() | Domain d1ed3e_: 1ed3 E: [20850] Other proteins in same PDB: d1ed3a1, d1ed3a2, d1ed3d1, d1ed3d2 |
PDB Entry: 1ed3 (more details), 2.55 Å
SCOP Domain Sequences for d1ed3e_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ed3e_ b.1.1.2 (E:) beta2-microglobulin {Rat (Rattus norvegicus) [TaxId: 10116]} iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
Timeline for d1ed3e_: