Lineage for d1ed3e1 (1ed3 E:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (5 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species) 
Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [48964] (1 PDB entry) 
Domain d1ed3e1: 1ed3 E: [20850]
Other proteins in same PDB: d1ed3a2, d1ed3d2
Details for d1ed3e1
PDB Entry: 1ed3 (more details), 2.55 Å
PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.
SCOP Domain Sequences for d1ed3e1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ed3e1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Rat (Rattus norvegicus), RT1-AA}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm
SCOP Domain Coordinates for d1ed3e1:
Click to download the PDB-style file with coordinates for d1ed3e1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ed3e1:
- d1ed3e1 appears in SCOP 1.57
- d1ed3e1 appears in the current release, SCOPe 2.08, called d1ed3e_
View in 3D
