Lineage for d1ed3e1 (1ed3 E:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 8170Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (19 species)
  7. 8369Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [48964] (1 PDB entry)
  8. 8373Domain d1ed3e1: 1ed3 E: [20850]
    Other proteins in same PDB: d1ed3a2, d1ed3d2

Details for d1ed3e1

PDB Entry: 1ed3 (more details), 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.

SCOP Domain Sequences for d1ed3e1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ed3e1 b.1.1.2 (E:) Class I MHC, beta2-microglobulin and alpha-3 domain {Rat (Rattus norvegicus), RT1-AA}
iqktpqiqvysrhppengkpnflncyvsqfhppqieiellkngkkipniemsdlsfskdw
sfyilahteftptetdvyacrvkhvtlkepktvtwdrdm

SCOP Domain Coordinates for d1ed3e1:

Click to download the PDB-style file with coordinates for d1ed3e1.
(The format of our PDB-style files is described here.)

Timeline for d1ed3e1: