SCOP 1.75: Domain d1ed3a1: 1ed3 A:182-275

Lineage for d1ed3a1 (1ed3 A:182-275)

1. Root: SCOP 1.75

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein Class I MHC, alpha-3 domain [88604] (4 species)

7. Species Rat (Rattus norvegicus), RT1-AA [TaxId:10116] [88607] (3 PDB entries)

8. Domain d1ed3a1: 1ed3 A:182-275 [20847]
   Other proteins in same PDB: d1ed3a2, d1ed3b_, d1ed3d2, d1ed3e_

Details for d1ed3a1

PDB Entry: 1ed3, 2.55 Å

PDB Description: crystal structure of rat minor histocompatibility antigen complex rt1- aa/mtf-e.

PDB Compounds: (A:) class I major histocompatibility antigen rt1-aa

SCOP Domain Sequences for d1ed3a1:

Sequence; same for both SEQRES and ATOM records:

>d1ed3a1 b.1.1.2 (A:182-275) Class I MHC, alpha-3 domain {Rat (Rattus norvegicus), RT1-AA [TaxId: 10116]}
sdppeahvtlhprpegdvtlrcwalgfypaditltwqlngedltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrveheglpkplsqrwe

Timeline for d1ed3a1:

• d1ed3a1 first appeared (with stable ids) in SCOP 1.55
  
• d1ed3a1 appears in SCOP 1.73
  
• d1ed3a1 appears in SCOPe 2.01
  
• d1ed3a1 appears in the current release, SCOPe 2.08