Lineage for d1biib_ (1bii B:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1510240Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1510241Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 1513476Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 1513477Protein beta2-microglobulin [88600] (5 species)
  7. 1514079Species Mouse (Mus musculus) [TaxId:10090] [88603] (168 PDB entries)
    Uniprot P01887
  8. 1514285Domain d1biib_: 1bii B: [20844]
    Other proteins in same PDB: d1biia1, d1biia2

Details for d1biib_

PDB Entry: 1bii (more details), 2.4 Å

PDB Description: the crystal structure of h-2dd mhc class i in complex with the hiv-1 derived peptide p18-110
PDB Compounds: (B:) beta-2 microglobulin

SCOPe Domain Sequences for d1biib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1biib_ b.1.1.2 (B:) beta2-microglobulin {Mouse (Mus musculus) [TaxId: 10090]}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOPe Domain Coordinates for d1biib_:

Click to download the PDB-style file with coordinates for d1biib_.
(The format of our PDB-style files is described here.)

Timeline for d1biib_: