![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.4: I set domains [49159] (39 proteins) |
![]() | Protein automated matches [190803] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries) |
![]() | Domain d3ay4c1: 3ay4 C:5-86 [208426] Other proteins in same PDB: d3ay4a1, d3ay4a2, d3ay4b1, d3ay4b2 automated match to d1fnla1 |
PDB Entry: 3ay4 (more details), 2.2 Å
SCOPe Domain Sequences for d3ay4c1:
Sequence, based on SEQRES records: (download)
>d3ay4c1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpkavvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvd dsgeyrcqtqlstlsdpvqlev
>d3ay4c1 b.1.1.4 (C:5-86) automated matches {Human (Homo sapiens) [TaxId: 9606]} lpkavvflepqwyrvlekdsvtlkcqqwfhneslissqassyfidaatvddsgeyrcqtq lstlsdpvqlev
Timeline for d3ay4c1:
![]() Domains from other chains: (mouse over for more information) d3ay4a1, d3ay4a2, d3ay4b1, d3ay4b2 |