Lineage for d3axla2 (3axl A:130-218)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2030580Species Mouse (Mus musculus) [TaxId:10090] [224855] (498 PDB entries)
  8. 2031186Domain d3axla2: 3axl A:130-218 [208415]
    Other proteins in same PDB: d3axla1, d3axlb1, d3axlg1, d3axlh1
    automated match to d1qrnd2

Details for d3axla2

PDB Entry: 3axl (more details), 2.9 Å

PDB Description: Murine Valpha 10 Vbeta 8.1 T-cell receptor
PDB Compounds: (A:) Valpha 10

SCOPe Domain Sequences for d3axla2:

Sequence, based on SEQRES records: (download)

>d3axla2 b.1.1.2 (A:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d3axla2 b.1.1.2 (A:130-218) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
iqnpdpavyqlrdvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsavawsnk
sdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d3axla2:

Click to download the PDB-style file with coordinates for d3axla2.
(The format of our PDB-style files is described here.)

Timeline for d3axla2: