Lineage for d1ldpl_ (1ldp L:)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 220417Protein Class I MHC, beta2-microglobulin and alpha-3 domain [48945] (20 species)
  7. 220710Species Mouse (Mus musculus), H-2LD [TaxId:10090] [48962] (2 PDB entries)
  8. 220716Domain d1ldpl_: 1ldp L: [20840]
    Other proteins in same PDB: d1ldph2
    complexed with nag; mutant

Details for d1ldpl_

PDB Entry: 1ldp (more details), 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides

SCOP Domain Sequences for d1ldpl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldpl_ b.1.1.2 (L:) Class I MHC, beta2-microglobulin and alpha-3 domain {Mouse (Mus musculus), H-2LD}
iqktpqiqvysrhppengkpnilncyvtqfhpphieiqmlkngkkipkvemsdmsfskdw
sfyilahteftptetdtyacrvkhdsmaepktvywdrdm

SCOP Domain Coordinates for d1ldpl_:

Click to download the PDB-style file with coordinates for d1ldpl_.
(The format of our PDB-style files is described here.)

Timeline for d1ldpl_: