SCOPe 2.05: Domain d3awja1: 3awj A:20-245

Lineage for d3awja1 (3awj A:20-245)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.95: Thiolase-like [53900] (1 superfamily)
   consists of two similar domains related by pseudo dyad; duplication
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32451; strand 5 is antiparallel to the rest

4. Superfamily c.95.1: Thiolase-like [53901] (3 families)

5. Family c.95.1.0: automated matches [196908] (1 protein)
   not a true family

6. Protein automated matches [196909] (52 species)
   not a true protein

7. Species Huperzia serrata [TaxId:355589] [226198] (2 PDB entries)

8. Domain d3awja1: 3awj A:20-245 [208392]
   automated match to d1cmla1
   complexed with coa, so4

Details for d3awja1

PDB Entry: 3awj, 2.2 Å

PDB Description: Crystal structure of the Huperzia serrata polyketide synthase 1 complexed with CoA-SH

PDB Compounds: (A:) Chalcone synthase-like polyketide synthase

SCOPe Domain Sequences for d3awja1:

Sequence; same for both SEQRES and ATOM records:

>d3awja1 c.95.1.0 (A:20-245) automated matches {Huperzia serrata [TaxId: 355589]}
vikpdgpatilaigtsnptnifeqstypdfffdvtncndktelkkkfqricdksgikkrh
fhltdeilrknpsickfkeasldprqdiavlevpklakeaaisaikqwgqpkskithlvf
attsgvdmpgadfqlakllglrptvkrvmlyqqgcyagatvlrvakdlaennkgarvlva
csevtavtfrapsethldglvgsalfgdgaaalivgsdpvpqeekp

Timeline for d3awja1:

• d3awja1 first appeared in SCOPe 2.03
  
• d3awja1 appears in SCOPe 2.04
  
• d3awja1 appears in SCOPe 2.06
  
• d3awja1 appears in the current release, SCOPe 2.08