Lineage for d1ldph1 (1ldp H:182-272)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 932656Protein Class I MHC, alpha-3 domain [88604] (4 species)
  7. 932877Species Mouse (Mus musculus) [TaxId:10090] [88606] (89 PDB entries)
    Uniprot P01901 22-299
  8. 933014Domain d1ldph1: 1ldp H:182-272 [20839]
    Other proteins in same PDB: d1ldph2, d1ldpl_
    complexed with ndg

Details for d1ldph1

PDB Entry: 1ldp (more details), 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides
PDB Compounds: (H:) MHC class I h-2ld

SCOPe Domain Sequences for d1ldph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldph1 b.1.1.2 (H:182-272) Class I MHC, alpha-3 domain {Mouse (Mus musculus) [TaxId: 10090]}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltl

SCOPe Domain Coordinates for d1ldph1:

Click to download the PDB-style file with coordinates for d1ldph1.
(The format of our PDB-style files is described here.)

Timeline for d1ldph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldph2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ldpl_