Lineage for d1ldph1 (1ldp H:182-272)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 450778Fold b.1: Immunoglobulin-like beta-sandwich [48725] (23 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 450779Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 452577Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 452843Protein Class I MHC, alpha-3 domain [88604] (3 species)
  7. 452944Species Mouse (Mus musculus) [TaxId:10090] [88606] (60 PDB entries)
  8. 453031Domain d1ldph1: 1ldp H:182-272 [20839]
    Other proteins in same PDB: d1ldph2, d1ldpl_

Details for d1ldph1

PDB Entry: 1ldp (more details), 3.1 Å

PDB Description: crystal structure of murine mhc class i h-2ld with a mixture of bound peptides

SCOP Domain Sequences for d1ldph1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ldph1 b.1.1.2 (H:182-272) Class I MHC, alpha-3 domain {Mouse (Mus musculus)}
tdspkahvthhprskgevtlrcwalgfypaditltwqlngeeltqdmelvetrpagdgtf
qkwasvvvplgkeqnytcrvyheglpepltl

SCOP Domain Coordinates for d1ldph1:

Click to download the PDB-style file with coordinates for d1ldph1.
(The format of our PDB-style files is described here.)

Timeline for d1ldph1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1ldph2
View in 3D
Domains from other chains:
(mouse over for more information)
d1ldpl_